PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN46169.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 284aa    MW: 32149.8 Da    PI: 9.4958
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN46169.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-091054345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT eE +l+ +a + + ++   +W+++a++++ g+t  +++  + 
       KHN46169.1 10 KWTSEENKLFENALAVHDKDtpdRWHRVAEMIP-GKTVVDVIRQYK 54
                     8********************************.******998886 PP

2Myb_DNA-binding431e-13116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
       KHN46169.1 116 PWTEDEHKLFLLGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 160
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-4354IPR009057Homeodomain-like
PROSITE profilePS512939.999661IPR017884SANT domain
SMARTSM007178.4E-10759IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-11961IPR009057Homeodomain-like
CDDcd001672.24E-81056No hitNo description
PfamPF002495.1E-81055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11108165IPR009057Homeodomain-like
PROSITE profilePS5129420.757109165IPR017930Myb domain
SuperFamilySSF466892.47E-16111164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17112164IPR006447Myb domain, plants
SMARTSM007172.2E-12113163IPR001005SANT/Myb domain
PfamPF002493.3E-12116160IPR001005SANT/Myb domain
CDDcd001671.06E-10116161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEDNNSRSTK WTSEENKLFE NALAVHDKDT PDRWHRVAEM IPGKTVVDVI RQYKELEVDV  60
SNIEAGLIPV PGYSSTATSP FTLDWVNTPG YDGFKGCGKR SSSVRPIEHE RKKGVPWTED  120
EHKLFLLGLK KYGKGDWRNI SRNFVITRTP TQVASHAQKY FIRQLSGGKD KRRASIHDIT  180
TVNLTETITT SSEDTNGSSS PHVLSQQQQP NSTPTTPRTR FQWSNQSNTG VAMTLNPAHE  240
RVFMSHYGAN SFGVKIEGQN LHESSYLRPQ TQNMVFQMQQ SSQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-15177177RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-156AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519244.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-115DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2SNN80.0A0A0B2SNN8_GLYSO; Transcription factor MYB1R1
STRINGGLYMA02G39000.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-81MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]